Re: [Gen-art] Gen-ART Last Call review of draft-ietf-opsawg-finding-geofeeds-06
Paul Kyzivat <pkyzivat@alum.mit.edu> Fri, 30 April 2021 14:31 UTC
Return-Path: <pkyzivat@alum.mit.edu>
X-Original-To: gen-art@ietfa.amsl.com
Delivered-To: gen-art@ietfa.amsl.com
Received: from localhost (localhost [127.0.0.1]) by ietfa.amsl.com (Postfix) with ESMTP id D643D3A19FE for <gen-art@ietfa.amsl.com>; Fri, 30 Apr 2021 07:31:08 -0700 (PDT)
X-Virus-Scanned: amavisd-new at amsl.com
X-Spam-Flag: NO
X-Spam-Score: -1.234
X-Spam-Level:
X-Spam-Status: No, score=-1.234 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, DKIM_SIGNED=0.1, DKIM_VALID=-0.1, NICE_REPLY_A=-0.001, SPF_HELO_NONE=0.001, SPF_SOFTFAIL=0.665, URIBL_BLOCKED=0.001] autolearn=no autolearn_force=no
Authentication-Results: ietfa.amsl.com (amavisd-new); dkim=pass (2048-bit key) header.d=comcastmailservice.net
Received: from mail.ietf.org ([4.31.198.44]) by localhost (ietfa.amsl.com [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id bWE00kPeZxkW for <gen-art@ietfa.amsl.com>; Fri, 30 Apr 2021 07:31:05 -0700 (PDT)
Received: from resqmta-ch2-06v.sys.comcast.net (resqmta-ch2-06v.sys.comcast.net [IPv6:2001:558:fe21:29:69:252:207:38]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by ietfa.amsl.com (Postfix) with ESMTPS id 1E7533A19FD for <gen-art@ietf.org>; Fri, 30 Apr 2021 07:31:05 -0700 (PDT)
Received: from resomta-ch2-04v.sys.comcast.net ([69.252.207.100]) by resqmta-ch2-06v.sys.comcast.net with ESMTP id cT9gljisEsjoScUAYlnojw; Fri, 30 Apr 2021 14:31:02 +0000
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=comcastmailservice.net; s=20180828_2048; t=1619793062; bh=HG+pfWzz4k8cHa0kY7QPYDXv3V77h4cfNmRLzKzGKow=; h=Received:Received:Subject:To:From:Message-ID:Date:MIME-Version: Content-Type; b=MLuDvdsgZZ7OfGeiQAFTsP2TZCxbT6geW7TIIWjeoSML0nICyzDjgi+2MjJmkjjno arW66XBF6IvWtVSRE1aGMJY/VQx2O9cbCVRMlKsWPVC8zPhiAacSYGTJI3FJbJ21tS B0ijRpu+aG4Nz/6U6Ix+4ulYj5y6WP2+ylixUibHLg3SvldI+MrgPWCGwD0a6suClX 8CNNu9/q4qCNwybgj+zTCgKrAWRJR2gxlPylrCCMxU1Bd9EwxPLNkFU6wjXSAJJhf7 5M4Rqcd85MjOoFP7KlnbtPQ3MG7VOYVk7lDSN9+O3HspEGQ01sIpU8JI36C46kRwdb cAtMJAk1wAujg==
Received: from MacBook-Air.localdomain ([24.62.227.142]) by resomta-ch2-04v.sys.comcast.net with ESMTPA id cUAWlAPGOdYTncUAXlyiY9; Fri, 30 Apr 2021 14:31:02 +0000
X-Xfinity-VAAS: gggruggvucftvghtrhhoucdtuddrgeduledrvddviedgjeekucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuvehomhgtrghsthdqtfgvshhipdfqfgfvpdfpqffurfetoffkrfenuceurghilhhouhhtmecufedtudenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhepuffvfhfhkffffgggjggtgfesthejredttdefjeenucfhrhhomheprfgruhhlucfmhiiiihhvrghtuceophhkhiiiihhvrghtsegrlhhumhdrmhhithdrvgguuheqnecuggftrfgrthhtvghrnhepleeghffgkeehveffjeetueffjedvgeeviedtveetteeiffelffeikeevleetjefhnecukfhppedvgedriedvrddvvdejrddugedvnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehhvghlohepofgrtgeuohhokhdqtehirhdrlhhotggrlhguohhmrghinhdpihhnvghtpedvgedriedvrddvvdejrddugedvpdhmrghilhhfrhhomhepphhkhiiiihhvrghtsegrlhhumhdrmhhithdrvgguuhdprhgtphhtthhopehgvghnqdgrrhhtsehivghtfhdrohhrghdprhgtphhtthhopegurhgrfhhtqdhivghtfhdqohhpshgrfihgqdhfihhnughinhhgqdhgvghofhgvvggushdrrghllhesihgvthhfrdhorhhgpdhrtghpthhtoheprhgrnhguhiesphhsghdrtghomh
X-Xfinity-VMeta: sc=-100.00;st=legit
To: Randy Bush <randy@psg.com>
Cc: draft-ietf-opsawg-finding-geofeeds.all@ietf.org, General Area Review Team <gen-art@ietf.org>
References: <998c5da7-df2b-3741-4473-332ac4d59b97@alum.mit.edu> <m2zgxgvnns.wl-randy@psg.com>
From: Paul Kyzivat <pkyzivat@alum.mit.edu>
Message-ID: <9bb8da6c-b88d-6826-56bf-34b4c08ae082@alum.mit.edu>
Date: Fri, 30 Apr 2021 10:31:00 -0400
User-Agent: Mozilla/5.0 (Macintosh; Intel Mac OS X 10.15; rv:78.0) Gecko/20100101 Thunderbird/78.10.0
MIME-Version: 1.0
In-Reply-To: <m2zgxgvnns.wl-randy@psg.com>
Content-Type: text/plain; charset="utf-8"; format="flowed"
Content-Language: en-US
Content-Transfer-Encoding: 7bit
Archived-At: <https://mailarchive.ietf.org/arch/msg/gen-art/MkdSoK5LsxWI-UyA3lMSZ_ZGiTU>
Subject: Re: [Gen-art] Gen-ART Last Call review of draft-ietf-opsawg-finding-geofeeds-06
X-BeenThere: gen-art@ietf.org
X-Mailman-Version: 2.1.29
Precedence: list
List-Id: "GEN-ART: General Area Review Team" <gen-art.ietf.org>
List-Unsubscribe: <https://www.ietf.org/mailman/options/gen-art>, <mailto:gen-art-request@ietf.org?subject=unsubscribe>
List-Archive: <https://mailarchive.ietf.org/arch/browse/gen-art/>
List-Post: <mailto:gen-art@ietf.org>
List-Help: <mailto:gen-art-request@ietf.org?subject=help>
List-Subscribe: <https://www.ietf.org/mailman/listinfo/gen-art>, <mailto:gen-art-request@ietf.org?subject=subscribe>
X-List-Received-Date: Fri, 30 Apr 2021 14:31:09 -0000
Hi Randy, Comments inline. On 4/29/21 4:30 PM, Randy Bush wrote: > hi paul: > > thanks for the review. > >> 1) Minor: Definition of "remarks: Geofeed" >> >> Section 3 says: >> >> ... The format of the inetnum: geofeed >> attribute MUST be as in this example, "remarks: Geofeed" followed by >> a URL ... >> >> From the examples and common sense there should be a space preceding >> the URL. But the text doesn't mention this. >> >> I suggest changing to: >> >> ... The format of the inetnum: geofeed >> attribute MUST be as in this example, "remarks: Geofeed " followed by >> a URL ... > > aha! good one. thanks. > >> Also, is the word "Geofeed" case sensitive? > > "MUST be as in this example." do we need ABNF the ex compiler hacker > asks? i can add enough syntactic sugar to give you a diabetic coma :) I don't think you need abnf. But some text specifying it is/isn't case sensitive would help. It may not be necessary if there is a strong established policy for handling case in RPSL. But even if there is it might not be applicable to processing the text of remarks. > i contend that it was good enough that your eagle eye caught a bug. > >> 2) Minor: Modification of RPSL >> >> Section 3 says: >> >> While we leave global agreement of RPSL modification to the relevant >> parties, we specify that a proper geofeed: attribute in the inetnum: >> class be simply "geofeed: " followed by a URL which will vary, but >> MUST refer only to a [RFC8805] geofeed file. >> ... >> Until all producers of inetnum:s, i.e. the RIRs, state that they have >> migrated to supporting a geofeed: attribute, consumers looking at >> inetnum:s to find geofeed URLs MUST be able to consume both the >> remarks: and geofeed: forms. >> >> This is a bit presumptive. You say you are leaving the RPSL >> modification to others, yet you are herein standardizing the exact >> form that modification must take. What if the relevant parties want to >> choose a different form? > > we have met the enemy and he is us -- pogo by walt kelly > > the work is being done in the ripe database wg of which most authors are > part. the wg is driving off this draft and really appreciates having > the syntax thrown over the wall. the ripe community is more cooperative > than the ietf. If these two efforts are already coordinated then all is well. >> 3) Minor/Nit: IANA Considerations >> >> I don't understand why this section is present. I don't find any >> reference of it within the document. > > 0 1197: SEQUENCE { > 4 917: SEQUENCE { > 8 3: [0] { > 10 1: INTEGER 2 > : } > 13 20: INTEGER 27AD394083D7F2B5B99B8670C775B2B96EE166E3 > 35 13: SEQUENCE { > 37 9: OBJECT IDENTIFIER > : sha256WithRSAEncryption (1 2 840 113549 1 1 11) <<<<<===== > 48 0: NULL > : } > ... > > you mean you don't read decoded certs for breakfast? No I don't. Now it is clear. > they are said to > make one strong. the few i have tried had other effects :) >> 4) NIT: Use of "awesome" >> >> I'm not sure how to feel about using *awesome* in the Introduction. It >> seems unusually informal for a standards document. But in a way I also >> find it refreshing. > > so do we. as i said to the kind opsdir reviewer, we'll see how far up > the chain a sense of perspective still exists. It will be interesting to see. >> IdNits reports a number of things worth looking into. Notably the >> downrefs > > the downrefs are only informational. they are the best doccos on > INETNUM today. sigh. But the references are included in the Normative References section. If you put them in an Informative References section then I think IdNits will be happy. >> and the lack of an IPv6 example. > > iij deployed ipv6 on our global network in '97, so i don't really feel a > strong need to pander to the insecurities of today's ipv6 fans. action > speaks louder than words. </snark>. Its only a matter of how much you want to fight mother nature (IdNits). If you "fix" the things it complains about then nobody will bring up the issue again. Thanks, Paul > as i said to kyle, secdir reviewer, unless someone pushes, i'll hold -07 > until a few more reviews come in. > > again, review MUCH appreciated. > > randy >
- [Gen-art] Gen-ART Last Call review of draft-ietf-… Paul Kyzivat
- Re: [Gen-art] Gen-ART Last Call review of draft-i… Randy Bush
- Re: [Gen-art] Gen-ART Last Call review of draft-i… Paul Kyzivat
- Re: [Gen-art] Gen-ART Last Call review of draft-i… Randy Bush
- Re: [Gen-art] Gen-ART Last Call review of draft-i… Randy Bush
- Re: [Gen-art] Gen-ART Last Call review of draft-i… Lars Eggert