[Uri-review] Re: draft-grimminck-safe-ioc-sharing
Graham Klyne <gk@ninebynine.org> Mon, 13 April 2026 10:50 UTC
Return-Path: <gk@ninebynine.org>
X-Original-To: uri-review@mail2.ietf.org
Delivered-To: uri-review@mail2.ietf.org
Received: from localhost (localhost [127.0.0.1]) by mail2.ietf.org (Postfix) with ESMTP id A87DCDB23A0A; Mon, 13 Apr 2026 03:50:04 -0700 (PDT)
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=ietf.org; s=ietf1; t=1776077404; bh=qQ3Gucm3nVPiTOcDGV1OuhwSo9uIu67bhrJpbwwurZA=; h=Subject:From:In-Reply-To:Date:Cc:References:To; b=m8X3RMDxzMBNEZTbiy3bCwNWhNnx21uVluvdPJIkWCAIuAO+pElS8uMxCjKEqjsh/ NwDWyRGrmRGOP9MpNvIRybpW/IIs7dHnPxcbVGKtocptxiI+yeSqKIYaVUldkBts2/ 0qjxj/mfmoB1l/fBEv2FRbvhOIt2aJUs4+sW4s9s=
X-Virus-Scanned: amavisd-new at ietf.org
X-Spam-Flag: NO
X-Spam-Score: -1.906
X-Spam-Level:
X-Spam-Status: No, score=-1.906 tagged_above=-999 required=5 tests=[BAYES_00=-1.9, DKIM_SIGNED=0.1, DKIM_VALID=-0.1, DKIM_VALID_AU=-0.1, DKIM_VALID_EF=-0.1, HTML_MESSAGE=0.001, MIME_HTML_ONLY=0.1, MIME_HTML_ONLY_MULTI=0.001, MIME_QP_LONG_LINE=0.001, MPART_ALT_DIFF=0.79, RCVD_IN_DNSWL_LOW=-0.7, RCVD_IN_VALIDITY_CERTIFIED_BLOCKED=0.001, RCVD_IN_VALIDITY_RPBL_BLOCKED=0.001, SPF_PASS=-0.001] autolearn=unavailable autolearn_force=no
Authentication-Results: mail2.ietf.org (amavisd-new); dkim=pass (2048-bit key) header.d=ninebynine.org header.b="HttOXQHW"; dkim=pass (2048-bit key) header.d=messagingengine.com header.b="QHmkxFBy"
Received: from mail2.ietf.org ([166.84.6.31]) by localhost (mail2.ietf.org [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id GSt4Vcq8rzCi; Mon, 13 Apr 2026 03:50:02 -0700 (PDT)
Received: from fout-b2-smtp.messagingengine.com (fout-b2-smtp.messagingengine.com [202.12.124.145]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature ECDSA (P-256) server-digest SHA256) (No client certificate requested) by mail2.ietf.org (Postfix) with ESMTPS id 52514DB23960; Mon, 13 Apr 2026 03:49:42 -0700 (PDT)
Received: from phl-compute-03.internal (phl-compute-03.internal [10.202.2.43]) by mailfout.stl.internal (Postfix) with ESMTP id ED06A1D0013C; Mon, 13 Apr 2026 06:49:34 -0400 (EDT)
Received: from phl-frontend-04 ([10.202.2.163]) by phl-compute-03.internal (MEProxy); Mon, 13 Apr 2026 06:49:35 -0400
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=ninebynine.org; h=cc:cc:content-transfer-encoding:content-type:content-type :date:date:from:from:in-reply-to:in-reply-to:message-id :mime-version:references:reply-to:subject:subject:to:to; s=fm2; t=1776077374; x=1776163774; bh=SrtnbxhaOrLHGgoQp/6Vx5VNlJ+1cq0l nbMz4ZxXBK8=; b=HttOXQHW7qhbcAMfbsrOrn0YwBnPvNr/DL3rK/3zggH0los3 0l9bUHNXrMyExDsqD00AOsWZE2Na2Wo8ubLqHRRbh5/2JqCnh/6i005YgZ9NAgjN nQ1GEJWfZ/yZws6qNL2OTGUrkr1yy3yWg07OW0KOcfBaVRgSdHPKpVF6vG7jCkqX nLAqN+7L+X6utUNwnLRt68cE7ACUnKCWUFp/nuKVJdeiB/XdZXGRp0sKrBHd3fzx NkQUZYMuA8zSXVs08gIvG0SgcAOTuQFpHc01co1J9Yk3AOFvk9ksmIFlAPL7oI69 yLrM8DRKhnWG08txLpiWULdAbQOBDMSvB+XF0w==
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:cc:content-transfer-encoding :content-type:content-type:date:date:feedback-id:feedback-id :from:from:in-reply-to:in-reply-to:message-id:mime-version :references:reply-to:subject:subject:to:to:x-me-proxy :x-me-sender:x-me-sender:x-sasl-enc; s=fm2; t=1776077374; x= 1776163774; bh=SrtnbxhaOrLHGgoQp/6Vx5VNlJ+1cq0lnbMz4ZxXBK8=; b=Q HmkxFBy12Xycu1Ir4pv5FgWIBj3JYlayYIv6rU33z+sSzL8BO3NQH5Ap4fFdFK6w ez2Y965YY/gGDtU7oXbNOpYcX1SNZyToRaRWIqGbkLuOD6cJsBxyY/YFoW8hgYGf Il+jI/RswH+jFawqDDAE0XD5VX552ZmjrUdHdodJBIPnm59LdUBxhTNweg9o3OPc KcdYhvSdyQckCgQC/kAHH1nbDI5hQlyF4nKXwgbXYi+9eARThB/FKfsg/nYMW0P7 PijIgs45dIZSusiuhRcratXEJ4OcA7TXDLKWV3VhNpYSXWyLEIHTkb3MpYOmReQj 4Nd+YvnQ6laHJxiD4Z6eA==
X-ME-Sender: <xms:PsrcaYy6x59CbZ3kvR4_qOF6Qq4-j5wf0mqlEd3fpyf1zwXuwuN7pQ> <xme:Psrcaeg5gtlKmkVwi83FAvT01DKePFPNneoE_JhsauZYUzfADw-YbqUQh_uN6HLR7 eBMsQgHhveWTSXyE5sbbaraICpS2JawsoIUAJqO6u8yxJIHEmJd7A>
X-ME-Received: <xmr:PsrcacnznBlwZonqZGJ3N4QTGTrUKCAmE-AZ4TcIiRO5HfPiD2NJZXyce-c0t1Y4sdTj>
X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeefhedrtddtgdefkedtfecutefuodetggdotefrod ftvfcurfhrohhfihhlvgemucfhrghsthforghilhdpuffrtefokffrpgfnqfghnecuuegr ihhlohhuthemuceftddtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenqfhnlh ihuchonhgvuchprghrthculdehuddmnecujfgurheptgfgggfuhfgjffevkfhfvffosegr jehmrehhtdejnecuhfhrohhmpefirhgrhhgrmhcumfhlhihnvgcuoehgkhesnhhinhgvsg ihnhhinhgvrdhorhhgqeenucggtffrrghtthgvrhhnpeeiiefftdfgleehfeejieegtdfh ieetgffghfejueelledujeeifefftdethfeggeenucffohhmrghinhepihgrnhgrrdhorh hgpdgvgigrmhhplhgvrdgtohhmpdhivghtfhdrohhrghdprhhftgdqvgguihhtohhrrdho rhhgnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehmrghilhhfrhhomhepgh hksehnihhnvggshihnihhnvgdrohhrghdpnhgspghrtghpthhtohepjedpmhhouggvpehs mhhtphhouhhtpdhrtghpthhtohepmhgrrhhksegtohgrtghtuhhsrdgtohhmpdhrtghpth htoheprhhftgdqihhsvgesrhhftgdqvgguihhtohhrrdhorhhgpdhrtghpthhtoheptgho nhhtrggtthepgedtshhtvghfrghnghhrihhmmhhinhgtkhdrnhhlsegumhgrrhgtrdhivg htfhdrohhrghdprhgtphhtthhopehurhhiqdhrvghvihgvfiesihgvthhfrdhorhhgpdhr tghpthhtohepthgvugdrihgvthhfsehgmhgrihhlrdgtohhmpdhrtghpthhtohepghhkse hnihhnvggshihnihhnvgdrohhrghdprhgtphhtthhopegurhgrfhhtqdhgrhhimhhmihhn tghkqdhsrghfvgdqihhotgdqshhhrghrihhnghesihgvthhfrdhorhhg
X-ME-Proxy: <xmx:PsrcacjQ1YTxP5Qp2k40j3T_vX4DmmiBFWrD8S57g3e9ohQPT4e91A> <xmx:PsrcaY1pstj9p8kTkKRD00wA18d3GAW28JWnAj7F6VOeD4MPNyJHBw> <xmx:PsrcadL-FHUxm6EVHen1Lwtb1XoPSsKM1dVnFsWhGFsQkLmKmRUVCg> <xmx:PsrcaQyHUzDJdRXTjtAnTqqmbbxuaYqG1BTxK0UFpBBG23c6NK7Kkg> <xmx:PsrcafYO4kpUV-57gAb3a6J87NWFNkLNg2STAUuQD1XChU6s71pZ5x7W>
Feedback-ID: i3b414768:Fastmail
Received: by mail.messagingengine.com (Postfix) with ESMTPA; Mon, 13 Apr 2026 06:49:33 -0400 (EDT)
Content-Type: multipart/alternative; boundary="Apple-Mail-A9A1B767-4A95-408B-9F96-FDD866F6FF15"
Content-Transfer-Encoding: 7bit
Mime-Version: 1.0 (1.0)
From: Graham Klyne <gk@ninebynine.org>
In-Reply-To: <2Eq32vEqs9jQZEbb2Tup4mZm6PgHH2Xd9TB9jKh6JI9APoO8o2-Q5_jfumCa2F1lMVv5eFfVSVzYbZT2y4u4ejXdttFa9btZBfG2UopeCwI=@stefangrimminck.nl>
Date: Mon, 13 Apr 2026 11:49:22 +0100
Message-Id: <8DBA0E76-EC9B-44F8-BF9B-0EF8E94BE17A@ninebynine.org>
References: <2Eq32vEqs9jQZEbb2Tup4mZm6PgHH2Xd9TB9jKh6JI9APoO8o2-Q5_jfumCa2F1lMVv5eFfVSVzYbZT2y4u4ejXdttFa9btZBfG2UopeCwI=@stefangrimminck.nl>
To: Stefan Grimminck <contact=40stefangrimminck.nl@dmarc.ietf.org>
X-Mailer: iPhone Mail (22H340)
Message-ID-Hash: BUBBKRZGAA5QX3CUGYV5S3P2SIOTAWR3
X-Message-ID-Hash: BUBBKRZGAA5QX3CUGYV5S3P2SIOTAWR3
X-MailFrom: gk@ninebynine.org
X-Mailman-Rule-Misses: dmarc-mitigation; no-senders; approved; emergency; loop; banned-address; member-moderation; header-match-uri-review.ietf.org-0; nonmember-moderation; administrivia; implicit-dest; max-recipients; max-size; news-moderation; no-subject; digests; suspicious-header
CC: Independent Submissions Editor <rfc-ise@rfc-editor.org>, Ted Hardie <ted.ietf@gmail.com>, uri-review@ietf.org, draft-grimminck-safe-ioc-sharing@ietf.org, Mark Baker <mark@coactus.com>
X-Mailman-Version: 3.3.9rc6
Precedence: list
Subject: [Uri-review] Re: draft-grimminck-safe-ioc-sharing
List-Id: Proposed URI Schemes <uri-review.ietf.org>
Archived-At: <https://mailarchive.ietf.org/arch/msg/uri-review/17yPCfJTpcv1fw1KyAbHzZTWcVk>
List-Archive: <https://mailarchive.ietf.org/arch/browse/uri-review>
List-Help: <mailto:uri-review-request@ietf.org?subject=help>
List-Owner: <mailto:uri-review-owner@ietf.org>
List-Post: <mailto:uri-review@ietf.org>
List-Subscribe: <mailto:uri-review-join@ietf.org>
List-Unsubscribe: <mailto:uri-review-leave@ietf.org>
On 13 Apr 2026, at 10:33, Stefan Grimminck <contact=40stefangrimminck.nl@dmarc.ietf.org> wrote:
Hi Eliot, and URI Review team,Thank you for the technical feedback and for the acknowledgement of the utility in formalizing these operational conventions.
I want to clear up what might be a misunderstanding first. The "illegal characters in the scheme" framing may have given the impression that the draft proposes something like h**p (asterisk substitution). The actual canonical form in the current draft is [scheme] bracketing:mailto:user@example.com -> [mailto]:user[@]example[.]com
Hopefully, your e-mail clients demonstrate this as well by not linkifying them :)The opening "[" is not permitted in a URI scheme name per RFC 3986 Section 3.1, so the result cannot be confused with a valid URI or collide with any IANA registration. It scales to any scheme ([https], [ftp], [smb], [sftp]) without needing a per-scheme mapping table, and it is consistent with how the draft already handles dots and at-signs.
The legacy tokens hxxp and hxxps are documented as fielded but NOT RECOMMENDED for new output. The reason they are not recommended is that character substitution does not scale. Each scheme needs its own mapping and there is no predictable rule (sftp could become sfxp, sxtp or sxxp). Legacy substitution prevents deterministic de-obfuscation because distinct protocols like SMTP and SFTP could collapse into identical tokens, whereas bracketing ensures a unique, reversible mapping. Furthermore, a substituted string like hxxp still looks like a syntactically valid scheme name, meaning future protocol obfuscations could collide with existing registrations.
Bracket wrapping avoids these problems while standardizing how indicators are shared in a scalable way. Implementations are expected to recognize hxxp and hxxps during de-obfuscation for backward compatibility. Practitioners who already rely on hxxp can keep doing so, and tooling will handle both forms if the implementer chooses to.
Based on the review feedback, I'm planning the following changes for -09:
- Adding RFC 5891 (IDNA 2008) as a reference for the Internationalized Domain Names edge case. Appreciate the pointer, and correction that RFC 3490 is obsoleted by RFC 5891.
- Reframing the IPv6 rationale in Step 3. The text currently states that IPv6 "does not trigger auto-linking in typical software," which I agree should not be presented as a permanent justification. I plan to replace this with a technical rationale.
Regarding the DISPATCH question: I presented a previous version of this draft to SECDISPATCH last April and received supportive feedback from Eric Rescorla, Rich Salz, and Andrew S2.
Thanks again for your time and expertise.
Best regards,Stefan GrimminckOn Sunday, April 12th, 2026 at 11:42, Independent Submissions Editor (Eliot Lear) <rfc-ise@rfc-editor.org> wrote:_______________________________________________
Hi URI Review team,
Thanks very much for your comments. Ted, in answer to your question, I am not aware that this work has been presented to the IETF. Stefan may do so if he wishes, and I would assist him if he wishes to see the work DISPATCHed. Stefan, please take note that at least one reviewer here prefers the way you originally approached the work, and revise as you see fit. Also, please take note of Martin's concerns below.
Eliot
ps: I will be unavailabe for the next two weeks. Expect responses after that point.
On 11.04.2026 04:09, Martin J. Dürst wrote:
Hello Eliot, others,
One detail that caught my eye is in https://www.ietf.org/archive/id/draft-grimminck-safe-ioc-sharing-08.html#name-step-3-host" target="_blank" rel="noreferrer nofollow noopener">https://www.ietf.org/archive/id/draft-grimminck-safe-ioc-sharing-08.html#name-step-3-host:
>>>>
IPv6 addresses use colon-hexadecimal notation inside square brackets (e.g., "[2001:db8::1]"), which does not trigger auto-linking in typical software; the entire bracket-enclosed literal, including any dots within it (e.g., the dots in "::ffff:192.0.2.1"), MUST be left unchanged.
>>>>
The part up to the semicolon is most probably true, but leaving this unchanged would make it more difficult to fix that. We shouldn't put additional blocks in front of IPv6 deployment and usage, even if they are small.
An additional comment below.
On 2026-04-11 01:09, Ted Hardie wrote:
Hi Eliot,
As a meta-question was this draft brought to the IETF before going to the
ISE? I don't see any record of it in places I would expect (DISPATCH,
SAAG), but my records may be incomplete.
After a quick read, this actually seems like something that the IETF should
consider, as there are some aspects of it that probably need wider review.
An example here is Section 9, which references how to handle IDNs. It
describes punycode, but the overall IDNA standard should be referenced,
probably especially RFC 3490, Section 3.1.
Which is obsoleted by RFC 5890.
Regards, Martin.
On the question related to the existing registration, RFC 7595 says:
There must not already be an entry with the same scheme name. In
the unfortunate case that there are multiple, different uses of
the same scheme name, the Designated Expert can approve a request
to modify an existing entry to note the separate use.
I would first contact Hugo Salgado, the original registrant, to see if he
would be willing to work with this author on the draft and to transfer the
registration. Since the use is functionally the same (though the
surrounding advice is different), I don't see a particular need to shift
the registration, but if this is desired and the original registrant is
unavailable, I believe the designated expert could invoke the clause above
and add the new document.
regards,
Ted Hardie
On Fri, Apr 10, 2026 at 4:38 PM Independent Submissions Editor (Eliot Lear)
<rfc-ise@rfc-editor.org> wrote:
Dear URI reviewers,
The Independent Submissions Editor has received a publication request for
draft-grimminck-safe-ioc-sharing. This draft intentionally makes certain
URIs unresolvable during transport. I am contacting you because there are
several legacy use cases, two in particular: http-> hxxp and https ->
hxxps. I have no doubt, but that these indicators of compromise (IOC)
transformations are widely accepted as a convention. I note that an old
draft, draft-salgado-hxxp-01 has provisionally registered these schemes.
This is sufficient to limit damage with those particular schemes. There
can be other schemes that may be used to reference compromised content.
I have several questions for this group:
- Stefan is considering a more generic approach that uses illegal
characters in the scheme (*) for other schemes. Do you agree that is
appropriate?
- Would you like the registration for hxxp and hxxps to move to this
work, should it progress?
- Would you like to mark the registrations as permanent as part of
that process?
- Would you like to perform a review of the draft? Reviewer guidance
can be found at https://www.rfc-editor.org/materials/reviewer.guide.txt" target="_blank" rel="noreferrer nofollow noopener">https://www.rfc-editor.org/materials/reviewer.guide.txt
.
Regards,
Eliot
_______________________________________________
Uri-review mailing list -- uri-review@ietf.org
To unsubscribe send an email to uri-review-leave@ietf.org
_______________________________________________
Uri-review mailing list -- uri-review@ietf.org
To unsubscribe send an email to uri-review-leave@ietf.org
Uri-review mailing list -- uri-review@ietf.org
To unsubscribe send an email to uri-review-leave@ietf.org
- [Uri-review] draft-grimminck-safe-ioc-sharing Independent Submissions Editor (Eliot Lear)
- [Uri-review] Re: draft-grimminck-safe-ioc-sharing Frank Denis
- [Uri-review] Re: draft-grimminck-safe-ioc-sharing Ted Hardie
- [Uri-review] Re: draft-grimminck-safe-ioc-sharing Martin J. Dürst
- [Uri-review] Re: draft-grimminck-safe-ioc-sharing Independent Submissions Editor (Eliot Lear)
- [Uri-review] Re: draft-grimminck-safe-ioc-sharing Stefan Grimminck
- [Uri-review] Re: draft-grimminck-safe-ioc-sharing Graham Klyne
- [Uri-review] Re: draft-grimminck-safe-ioc-sharing Independent Submissions Editor (Eliot Lear)
- [Uri-review] Re: draft-grimminck-safe-ioc-sharing Martin J. Dürst
- [Uri-review] Re: draft-grimminck-safe-ioc-sharing Stefan Grimminck
- [Uri-review] Re: draft-grimminck-safe-ioc-sharing Stefan Grimminck
- [Uri-review] Re: draft-grimminck-safe-ioc-sharing Independent Submissions Editor (Eliot Lear)
- [Uri-review] Re: draft-grimminck-safe-ioc-sharing Graham Klyne
- [Uri-review] Re: draft-grimminck-safe-ioc-sharing Eric Burger